![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.27: Ribosomal protein S16 [54564] (1 superfamily) |
![]() | Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) ![]() |
![]() | Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein) |
![]() | Protein Ribosomal protein S16 [54567] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54568] (11 PDB entries) |
![]() | Domain d1fjgp_: 1fjg P: [38444] Other proteins in same PDB: d1fjgb_, d1fjgc1, d1fjgc2, d1fjgd_, d1fjge1, d1fjge2, d1fjgf_, d1fjgg_, d1fjgh_, d1fjgi_, d1fjgj_, d1fjgk_, d1fjgl_, d1fjgm_, d1fjgn_, d1fjgo_, d1fjgq_, d1fjgr_, d1fjgs_, d1fjgt_, d1fjgv_ |
PDB Entry: 1fjg (more details), 3 Å
SCOP Domain Sequences for d1fjgp_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjgp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus} mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl svgaqptdtarrllrqagvfrqe
Timeline for d1fjgp_: