SCOP 1.57: Domain d1fjfp_: 1fjf P:

Lineage for d1fjfp_ (1fjf P:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)

4. Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family)

5. Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)

6. Protein Ribosomal protein S16 [54567] (1 species)

7. Species Thermus thermophilus [TaxId:274] [54568] (11 PDB entries)

8. Domain d1fjfp_: 1fjf P: [38443]
   Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfp_

PDB Entry: 1fjf, 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfp_:

Sequence; same for both SEQRES and ATOM records:

>d1fjfp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

Timeline for d1fjfp_:

• d1fjfp_ first appeared (with stable ids) in SCOP 1.55
  
• d1fjfp_ last appears in SCOP 1.59