Lineage for d1fjfp_ (1fjf P:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31571Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
  4. 31572Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 31573Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 31574Protein Ribosomal protein S16 [54567] (1 species)
  7. 31575Species Thermus thermophilus [TaxId:274] [54568] (7 PDB entries)
  8. 31576Domain d1fjfp_: 1fjf P: [38443]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfp_

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfp_ d.27.1.1 (P:) Ribosomal protein S16 {Thermus thermophilus}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOP Domain Coordinates for d1fjfp_:

Click to download the PDB-style file with coordinates for d1fjfp_.
(The format of our PDB-style files is described here.)

Timeline for d1fjfp_: