SCOPe 2.07: Domain d6t0bf_: 6t0b f:

Lineage for d6t0bf_ (6t0b f:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families)
   automatically mapped to Pfam PF02284

5. Family a.118.11.0: automated matches [384415] (1 protein)
   not a true family

6. Protein automated matches [384416] (1 species)
   not a true protein

7. Species Saccharomyces cerevisiae [TaxId:559292] [384417] (1 PDB entry)

8. Domain d6t0bf_: 6t0b f: [384418]
   Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bt_, d6t0bw_
   automated match to d1ocre_
   complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn

Details for d6t0bf_

PDB Entry: 6t0b, 2.8 Å

PDB Description: the iii2-iv(5b)2 respiratory supercomplex from s. cerevisiae

PDB Compounds: (f:) Cytochrome c oxidase subunit 6, mitochondrial

SCOPe Domain Sequences for d6t0bf_:

Sequence; same for both SEQRES and ATOM records:

>d6t0bf_ a.118.11.0 (f:) automated matches {Saccharomyces cerevisiae [TaxId: 559292]}
deetfeeftaryekefdeaydlfevqrvlnncfsydlvpapaviekalraarrvndlpta
irvfealkykvenedqykayldelkdvrqelgvplkeelfps

Timeline for d6t0bf_:

• d6t0bf_ is new in SCOPe 2.07-stable
  
• d6t0bf_ appears in the current release, SCOPe 2.08