![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (4 proteins) |
![]() | Protein Chitinase B [54560] (1 species) |
![]() | Species Serratia marcescens [TaxId:615] [54561] (5 PDB entries) |
![]() | Domain d1e15b3: 1e15 B:292-379 [38441] Other proteins in same PDB: d1e15a1, d1e15a2, d1e15b1, d1e15b2 |
PDB Entry: 1e15 (more details), 1.9 Å
SCOP Domain Sequences for d1e15b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e15b3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens} ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg nygyqrlwndktktpylyhaqnglfvty
Timeline for d1e15b3: