Lineage for d1e15b3 (1e15 B:292-379)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31479Fold d.26: FKBP-like [54533] (3 superfamilies)
  4. 31556Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 31557Family d.26.3.1: Chitinase insertion domain [54557] (3 proteins)
  6. 31567Protein Chitinase B [54560] (1 species)
  7. 31568Species Serratia marcescens [TaxId:615] [54561] (1 PDB entry)
  8. 31570Domain d1e15b3: 1e15 B:292-379 [38441]
    Other proteins in same PDB: d1e15a1, d1e15a2, d1e15b1, d1e15b2

Details for d1e15b3

PDB Entry: 1e15 (more details), 1.9 Å

PDB Description: chitinase b from serratia marcescens

SCOP Domain Sequences for d1e15b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e15b3 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

SCOP Domain Coordinates for d1e15b3:

Click to download the PDB-style file with coordinates for d1e15b3.
(The format of our PDB-style files is described here.)

Timeline for d1e15b3: