Lineage for d1ehna3 (1ehn A:444-516)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31479Fold d.26: FKBP-like [54533] (3 superfamilies)
  4. 31556Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 31557Family d.26.3.1: Chitinase insertion domain [54557] (3 proteins)
  6. 31561Protein Chitinase A [54558] (1 species)
  7. 31562Species Serratia marcescens [TaxId:615] [54559] (4 PDB entries)
  8. 31565Domain d1ehna3: 1ehn A:444-516 [38438]
    Other proteins in same PDB: d1ehna1, d1ehna2

Details for d1ehna3

PDB Entry: 1ehn (more details), 1.9 Å

PDB Description: crystal structure of chitinase a mutant e315q complexed with octa-n- acetylchitooctaose (nag)8.

SCOP Domain Sequences for d1ehna3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ehna3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens}
ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiagqfmsgewqytydataeapy
vfkpstgdlitfd

SCOP Domain Coordinates for d1ehna3:

Click to download the PDB-style file with coordinates for d1ehna3.
(The format of our PDB-style files is described here.)

Timeline for d1ehna3: