SCOPe 2.07: Domain d1roua_: 1rou A:

Lineage for d1roua_ (1rou A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein FKBP59-I, N-terminal domain [54545] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [54546] (2 PDB entries)

8. Domain d1roua_: 1rou A: [38430]

Details for d1roua_

PDB Entry: 1rou

PDB Description: structure of fkbp59-i, the n-terminal domain of a 59 kda fk506-binding protein, nmr, 22 structures

PDB Compounds: (A:) fkbp59-I

SCOPe Domain Sequences for d1roua_:

Sequence; same for both SEQRES and ATOM records:

>d1roua_ d.26.1.1 (A:) FKBP59-I, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gvdispkqdegvlkvikregtgtetpmigdrvfvhytgwlldgtkfdssldrkdkfsfdl
gkgevikawdiavatmkvgelcritckpeyaygsagsppkippnatlvfevelfefkg

Timeline for d1roua_:

• d1roua_ first appeared (with stable ids) in SCOP 1.55, called d1rou__
  
• d1roua_ appears in SCOPe 2.06
  
• d1roua_ appears in the current release, SCOPe 2.08