| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins) |
| Protein FKBP59-I, N-terminal domain [54545] (1 species) |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [54546] (2 PDB entries) |
| Domain d1roua_: 1rou A: [38430] |
PDB Entry: 1rou (more details)
SCOPe Domain Sequences for d1roua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1roua_ d.26.1.1 (A:) FKBP59-I, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gvdispkqdegvlkvikregtgtetpmigdrvfvhytgwlldgtkfdssldrkdkfsfdl
gkgevikawdiavatmkvgelcritckpeyaygsagsppkippnatlvfevelfefkg
Timeline for d1roua_: