Lineage for d1roua_ (1rou A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2548393Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2548394Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2548395Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2548530Protein FKBP59-I, N-terminal domain [54545] (1 species)
  7. 2548531Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [54546] (2 PDB entries)
  8. 2548533Domain d1roua_: 1rou A: [38430]

Details for d1roua_

PDB Entry: 1rou (more details)

PDB Description: structure of fkbp59-i, the n-terminal domain of a 59 kda fk506-binding protein, nmr, 22 structures
PDB Compounds: (A:) fkbp59-I

SCOPe Domain Sequences for d1roua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1roua_ d.26.1.1 (A:) FKBP59-I, N-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gvdispkqdegvlkvikregtgtetpmigdrvfvhytgwlldgtkfdssldrkdkfsfdl
gkgevikawdiavatmkvgelcritckpeyaygsagsppkippnatlvfevelfefkg

SCOPe Domain Coordinates for d1roua_:

Click to download the PDB-style file with coordinates for d1roua_.
(The format of our PDB-style files is described here.)

Timeline for d1roua_: