Lineage for d6t0bh_ (6t0b H:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2630215Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
  4. 2631316Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 2631317Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 2631318Protein Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81506] (3 species)
    together with cytochrome b binds to ubiquinone
  7. 2631319Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [81505] (10 PDB entries)
  8. 2631332Domain d6t0bh_: 6t0b H: [384255]
    Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bs_, d6t0bt_, d6t0bw_
    automated match to d3cx5h_
    complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn

Details for d6t0bh_

PDB Entry: 6t0b (more details), 2.8 Å

PDB Description: the iii2-iv(5b)2 respiratory supercomplex from s. cerevisiae
PDB Compounds: (H:) Cytochrome b-c1 complex subunit 8

SCOPe Domain Sequences for d6t0bh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t0bh_ f.23.13.1 (H:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gppsgktymgwwghmggpkqkgitsyavspyaqkplqgifhnavfnsfrrfksqflyvli
pagiywywwkngneyneflyskagreelervnv

SCOPe Domain Coordinates for d6t0bh_:

Click to download the PDB-style file with coordinates for d6t0bh_.
(The format of our PDB-style files is described here.)

Timeline for d6t0bh_: