![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.1: MPP-like [63412] (7 proteins) Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal |
![]() | Protein automated matches [254430] (2 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [257462] (3 PDB entries) |
![]() | Domain d6t0ba1: 6t0b A:27-239 [384213] Other proteins in same PDB: d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bs_, d6t0bt_, d6t0bw_ automated match to d3cx5a1 complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn |
PDB Entry: 6t0b (more details), 2.8 Å
SCOPe Domain Sequences for d6t0ba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6t0ba1 d.185.1.1 (A:27-239) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} aevtqlsngivvatehnpsahtasvgvvfgsgaanenpynngvsnlwkniflskensava akeglalssnisrdfqsyivsslpgstdksldflnqsfiqqkanllsssnfeatkksvlk qvqdfeendhpnrvlehlhstafqntplslptrgtleslenlvvadlesfannhflnsna vvvgtgnikhedlvnsiesknlslqtgtkpvlk
Timeline for d6t0ba1:
![]() Domains from other chains: (mouse over for more information) d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bs_, d6t0bt_, d6t0bw_ |