Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) automatically mapped to Pfam PF05365 |
Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
Protein automated matches [190326] (4 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [187308] (5 PDB entries) |
Domain d6t0bt_: 6t0b T: [384211] Other proteins in same PDB: d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bs_, d6t0bw_ automated match to d3cx5i_ complexed with ca, cdl, cu, cua, fes, hea, hec, hem, mg, pcf, pef, zn |
PDB Entry: 6t0b (more details), 2.8 Å
SCOPe Domain Sequences for d6t0bt_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6t0bt_ f.23.14.1 (T:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} sfsslyktffkrnavfvgtifagafvfqtvfdtaitswyenhnkgklwkdvkariaa
Timeline for d6t0bt_:
View in 3D Domains from other chains: (mouse over for more information) d6t0ba1, d6t0ba2, d6t0bb1, d6t0bb2, d6t0bc1, d6t0bc2, d6t0bd1, d6t0bd2, d6t0be1, d6t0be2, d6t0bf_, d6t0bg_, d6t0bh_, d6t0bi_, d6t0bj_, d6t0bl1, d6t0bl2, d6t0bm1, d6t0bm2, d6t0bn1, d6t0bn2, d6t0bo1, d6t0bo2, d6t0bp1, d6t0bp2, d6t0bq_, d6t0br_, d6t0bs_, d6t0bw_ |