SCOP 1.71: Domain d1fks__: 1fks -

Lineage for d1fks__ (1fks -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (3 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)

6. Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
   cis-trans prolyl-isomerase

7. Species Human (Homo sapiens) [TaxId:9606] [54537] (31 PDB entries)

8. Domain d1fks__: 1fks - [38421]

Details for d1fks__

PDB Entry: 1fks

PDB Description: solution structure of fkbp, a rotamase enzyme and receptor for fk506 and rapamycin

SCOP Domain Sequences for d1fks__:

Sequence; same for both SEQRES and ATOM records:

>d1fks__ d.26.1.1 (-) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d1fks__:

• d1fks__ first appeared (with stable ids) in SCOP 1.55
  
• d1fks__ appears in SCOP 1.69
  
• d1fks__ is called d1fksa_ in SCOP 1.73
  
• d1fks__ appears in the current release, SCOPe 2.08, called d1fksa_