Lineage for d1f40a_ (1f40 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601019Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 601020Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 601021Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 601032Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 601036Species Human (Homo sapiens) [TaxId:9606] [54537] (31 PDB entries)
  8. 601079Domain d1f40a_: 1f40 A: [38419]
    complexed with gpi

Details for d1f40a_

PDB Entry: 1f40 (more details)

PDB Description: solution structure of fkbp12 complexed with gpi-1046, a neurotrophic ligand

SCOP Domain Sequences for d1f40a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f40a_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOP Domain Coordinates for d1f40a_:

Click to download the PDB-style file with coordinates for d1f40a_.
(The format of our PDB-style files is described here.)

Timeline for d1f40a_: