SCOPe 2.08: Domain d6pc4a2: 6pc4 A:246-437

Lineage for d6pc4a2 (6pc4 A:246-437)

Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families)
Family d.79.2.1: Tubulin, C-terminal domain [55308] (4 proteins)
Protein automated matches [227071] (7 species)
not a true protein
Species Pig (Sus scrofa) [TaxId:9823] [278816] (66 PDB entries)

Domain d6pc4a2: 6pc4 A:246-437 [384183]
Other proteins in same PDB: d6pc4a1, d6pc4b1, d6pc4c1, d6pc4d1, d6pc4e_, d6pc4f1, d6pc4f2, d6pc4f3
automated match to d4i50a2
complexed with ca, gdp, gtp, mes, mg, o91

Details for d6pc4a2

PDB Entry: 6pc4 (more details), 2.6 Å

PDB Description: tubulin-rb3_sld-ttl in complex with compound abi-274

PDB Compounds: (A:) Tubulin alpha-1B chain

SCOPe Domain Sequences for d6pc4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pc4a2 d.79.2.1 (A:246-437) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
galnvdltefqtnlvpyprihfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrsiqfvdwcptgfkvginyqpptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgv

SCOPe Domain Coordinates for d6pc4a2:

Click to download the PDB-style file with coordinates for d6pc4a2.
(The format of our PDB-style files is described here.)

Timeline for d6pc4a2: