Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) automatically mapped to Pfam PF00091 |
Family c.32.1.1: Tubulin, GTPase domain [52491] (4 proteins) |
Protein automated matches [226837] (9 species) not a true protein |
Species Pig (Sus scrofa) [TaxId:9823] [278808] (66 PDB entries) |
Domain d6pc4a1: 6pc4 A:1-245 [384182] Other proteins in same PDB: d6pc4a2, d6pc4b2, d6pc4c2, d6pc4d2, d6pc4e_, d6pc4f1, d6pc4f2, d6pc4f3 automated match to d5fnva1 complexed with ca, gdp, gtp, mes, mg, o91 |
PDB Entry: 6pc4 (more details), 2.6 Å
SCOPe Domain Sequences for d6pc4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pc4a1 c.32.1.1 (A:1-245) automated matches {Pig (Sus scrofa) [TaxId: 9823]} mrecisihvgqagvqignacwelyclehgiqpdgqmpsdktigggddsfntffsetgagk hvpravfvdleptvidevrtgtyrqlfhpeqlitgkedaannyarghytigkeiidlvld rirkladqctglqgflvfhsfgggtgsgftsllmerlsvdygkksklefsiypapqvsta vvepynsiltthttlehsdcafmvdneaiydicrrnldierptytnlnrlisqivssita slrfd
Timeline for d6pc4a1: