Lineage for d1qplc_ (1qpl C:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132234Fold d.26: FKBP-like [54533] (3 superfamilies)
  4. 132235Superfamily d.26.1: FKBP-like [54534] (2 families) (S)
  5. 132236Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (7 proteins)
  6. 132244Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
  7. 132248Species Human (Homo sapiens) [TaxId:9606] [54537] (29 PDB entries)
  8. 132288Domain d1qplc_: 1qpl C: [38418]

Details for d1qplc_

PDB Entry: 1qpl (more details), 2.9 Å

PDB Description: fk506 binding protein (12 kda, human) complex with l-707,587

SCOP Domain Sequences for d1qplc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qplc_ d.26.1.1 (C:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOP Domain Coordinates for d1qplc_:

Click to download the PDB-style file with coordinates for d1qplc_.
(The format of our PDB-style files is described here.)

Timeline for d1qplc_: