Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) |
Superfamily d.26.1: FKBP-like [54534] (2 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (7 proteins) |
Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54537] (29 PDB entries) |
Domain d1qplc_: 1qpl C: [38418] |
PDB Entry: 1qpl (more details), 2.9 Å
SCOP Domain Sequences for d1qplc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qplc_ d.26.1.1 (C:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)} gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
Timeline for d1qplc_: