Lineage for d1b6ce_ (1b6c E:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1022608Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1022609Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 1022610Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 1022621Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 1022625Species Human (Homo sapiens) [TaxId:9606] [54537] (39 PDB entries)
  8. 1022671Domain d1b6ce_: 1b6c E: [38415]
    Other proteins in same PDB: d1b6cb_, d1b6cd_, d1b6cf_, d1b6ch_
    complexed with so4

Details for d1b6ce_

PDB Entry: 1b6c (more details), 2.6 Å

PDB Description: crystal structure of the cytoplasmic domain of the type i tgf-beta receptor in complex with fkbp12
PDB Compounds: (E:) fk506-binding protein

SCOPe Domain Sequences for d1b6ce_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6ce_ d.26.1.1 (E:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOPe Domain Coordinates for d1b6ce_:

Click to download the PDB-style file with coordinates for d1b6ce_.
(The format of our PDB-style files is described here.)

Timeline for d1b6ce_: