SCOP 1.69: Domain d1b6ce_: 1b6c E:

Lineage for d1b6ce_ (1b6c E:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (3 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)

6. Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
   cis-trans prolyl-isomerase

7. Species Human (Homo sapiens) [TaxId:9606] [54537] (31 PDB entries)

8. Domain d1b6ce_: 1b6c E: [38415]
   Other proteins in same PDB: d1b6cb_, d1b6cd_, d1b6cf_, d1b6ch_

Details for d1b6ce_

PDB Entry: 1b6c, 2.6 Å

PDB Description: crystal structure of the cytoplasmic domain of the type i tgf-beta receptor in complex with fkbp12

SCOP Domain Sequences for d1b6ce_:

Sequence; same for both SEQRES and ATOM records:

>d1b6ce_ d.26.1.1 (E:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d1b6ce_:

• d1b6ce_ first appeared (with stable ids) in SCOP 1.55
  
• d1b6ce_ appears in SCOP 1.67
  
• d1b6ce_ appears in SCOP 1.71
  
• d1b6ce_ appears in the current release, SCOPe 2.08