SCOPe 2.07: Domain d6lt6a2: 6lt6 A:182-276

Lineage for d6lt6a2 (6lt6 A:182-276)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226134] (25 PDB entries)

8. Domain d6lt6a2: 6lt6 A:182-276 [384145]
   Other proteins in same PDB: d6lt6a1, d6lt6b_
   automated match to d1efxa1
   complexed with edo, ekg, na

Details for d6lt6a2

PDB Entry: 6lt6, 2.15 Å

PDB Description: crystal structure of rhesus macaque mhc class i molecule mamu-b*05104 complexed with lysophosphatidylcholine

PDB Compounds: (A:) MHC class I antigen

SCOPe Domain Sequences for d6lt6a2:

Sequence; same for both SEQRES and ATOM records:

>d6lt6a2 b.1.1.2 (A:182-276) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
adppkthvthhpvsdheatlrcwalgfypaeitltwqrdgedqtqdiefvetrpagdgtf
qkwgavvvpsgeeqrytchvqhkglpepltlrwep

Timeline for d6lt6a2:

• d6lt6a2 is new in SCOPe 2.07-stable
  
• d6lt6a2 appears in the current release, SCOPe 2.08