Lineage for d1b6ca_ (1b6c A:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 132234Fold d.26: FKBP-like [54533] (3 superfamilies)
  4. 132235Superfamily d.26.1: FKBP-like [54534] (2 families) (S)
  5. 132236Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (7 proteins)
  6. 132244Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
  7. 132248Species Human (Homo sapiens) [TaxId:9606] [54537] (29 PDB entries)
  8. 132283Domain d1b6ca_: 1b6c A: [38413]
    Other proteins in same PDB: d1b6cb_, d1b6cd_, d1b6cf_, d1b6ch_

Details for d1b6ca_

PDB Entry: 1b6c (more details), 2.6 Å

PDB Description: crystal structure of the cytoplasmic domain of the type i tgf-beta receptor in complex with fkbp12

SCOP Domain Sequences for d1b6ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b6ca_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOP Domain Coordinates for d1b6ca_:

Click to download the PDB-style file with coordinates for d1b6ca_.
(The format of our PDB-style files is described here.)

Timeline for d1b6ca_: