SCOP 1.75: Domain d1eymb_: 1eym B:

Lineage for d1eymb_ (1eym B:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (3 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)

6. Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
   cis-trans prolyl-isomerase

7. Species Human (Homo sapiens) [TaxId:9606] [54537] (33 PDB entries)

8. Domain d1eymb_: 1eym B: [38404]
   mutant

Details for d1eymb_

PDB Entry: 1eym, 2 Å

PDB Description: fk506 binding protein mutant, homodimeric complex

PDB Compounds: (B:) fk506 binding protein

SCOP Domain Sequences for d1eymb_:

Sequence; same for both SEQRES and ATOM records:

>d1eymb_ d.26.1.1 (B:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkmdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d1eymb_:

• d1eymb_ first appeared (with stable ids) in SCOP 1.55
  
• d1eymb_ appears in SCOP 1.73
  
• d1eymb_ appears in SCOPe 2.01
  
• d1eymb_ appears in the current release, SCOPe 2.08