Lineage for d1fkga_ (1fkg A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 720425Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 720426Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 720427Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 720438Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 720442Species Human (Homo sapiens) [TaxId:9606] [54537] (32 PDB entries)
  8. 720465Domain d1fkga_: 1fkg A: [38400]
    complexed with sb3

Details for d1fkga_

PDB Entry: 1fkg (more details), 2 Å

PDB Description: design, synthesis, and kinetic evaluation of high-affinity fkbp ligands, and the x-ray crystal structures of their complexes with fkbp12
PDB Compounds: (A:) fk506 binding protein

SCOP Domain Sequences for d1fkga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fkga_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOP Domain Coordinates for d1fkga_:

Click to download the PDB-style file with coordinates for d1fkga_.
(The format of our PDB-style files is described here.)

Timeline for d1fkga_: