Lineage for d1d7ia_ (1d7i A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857507Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 857508Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 857509Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 857520Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 857524Species Human (Homo sapiens) [TaxId:9606] [54537] (33 PDB entries)
  8. 857547Domain d1d7ia_: 1d7i A: [38396]

Details for d1d7ia_

PDB Entry: 1d7i (more details), 1.9 Å

PDB Description: fkbp complexed with methyl methylsulfinylmethyl sulfide (dss)
PDB Compounds: (A:) protein (fk506-binding protein)

SCOP Domain Sequences for d1d7ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7ia_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOP Domain Coordinates for d1d7ia_:

Click to download the PDB-style file with coordinates for d1d7ia_.
(The format of our PDB-style files is described here.)

Timeline for d1d7ia_: