Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
Protein automated matches [190091] (20 species) not a true protein |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [383877] (5 PDB entries) |
Domain d6xx8a1: 6xx8 A:2-333 [383941] Other proteins in same PDB: d6xx8a2, d6xx8b2 automated match to d1jwha_ |
PDB Entry: 6xx8 (more details), 1.8 Å
SCOPe Domain Sequences for d6xx8a1:
Sequence, based on SEQRES records: (download)
>d6xx8a1 d.144.1.7 (A:2-333) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} skarvytevnvirpkdywdyeslivqwgeqddyevvrkvgrgkysevfeginvnskekci ikilkpvkkkkirreikilqnlcggpnivklldvvrdqhsktpslifeyvnstdfkvlyp tltdydiryyiyellkaldfchsqgimhrdvkphnvmidhelrklrlidwglaefyhpgk eynvrvasryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnqdqlvkia kvlgtdelnaylnkyqleldpqlealvgrhsrkpwskfinadnqhlvspeaidfldkllr ydhqdrltakeamahayfaqvraaetsrmrsq
>d6xx8a1 d.144.1.7 (A:2-333) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} skarvytevnviyeslivqwgeqddyevvrkvgrgkysevfeginvnskekciikilkpv kkkkirreikilqnlcggpnivklldvvrdqhsktpslifeyvnstdfkvlyptltdydi ryyiyellkaldfchsqgimhrdvkphnvmidhelrklrlidwglaefyhpgkeynvrva sryfkgpellvdlqdydysldmwslgcmfagmifrkepffyghdnqdqlvkiakvlgtde lnaylnkyqleldpqlealvgrhsrkpwskfinadnqhlvspeaidfldkllrydhqdrl takeamahayfaqvraaetsrmrsq
Timeline for d6xx8a1: