Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (3 families) |
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins) |
Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species) cis-trans prolyl-isomerase |
Species Human (Homo sapiens) [TaxId:9606] [54537] (32 PDB entries) |
Domain d1d7jb_: 1d7j B: [38390] complexed with buq, nh4, so4 |
PDB Entry: 1d7j (more details), 1.85 Å
SCOP Domain Sequences for d1d7jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7jb_ d.26.1.1 (B:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
Timeline for d1d7jb_: