Lineage for d6yijd_ (6yij D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2319939Family a.29.2.1: Bromodomain [47371] (6 proteins)
  6. 2320024Protein automated matches [190366] (2 species)
    not a true protein
  7. 2320025Species Human (Homo sapiens) [TaxId:9606] [187201] (67 PDB entries)
  8. 2320153Domain d6yijd_: 6yij D: [383869]
    Other proteins in same PDB: d6yija2, d6yijb2, d6yijc2, d6yijf2
    automated match to d4nyxa_
    complexed with osn

Details for d6yijd_

PDB Entry: 6yij (more details), 2.2 Å

PDB Description: crystal structure of the crebbp bromodomain in complex with a benzo- diazepine ligand
PDB Compounds: (D:) crebbp

SCOPe Domain Sequences for d6yijd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6yijd_ a.29.2.1 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkld
tgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

SCOPe Domain Coordinates for d6yijd_:

Click to download the PDB-style file with coordinates for d6yijd_.
(The format of our PDB-style files is described here.)

Timeline for d6yijd_: