SCOPe 2.05: Domain d1fkba_: 1fkb A:

Lineage for d1fkba_ (1fkb A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
   cis-trans prolyl-isomerase

7. Species Human (Homo sapiens) [TaxId:9606] [54537] (42 PDB entries)

8. Domain d1fkba_: 1fkb A: [38385]
   complexed with rap

Details for d1fkba_

PDB Entry: 1fkb, 1.7 Å

PDB Description: atomic structure of the rapamycin human immunophilin fkbp-12 complex

PDB Compounds: (A:) fk506 binding protein

SCOPe Domain Sequences for d1fkba_:

Sequence; same for both SEQRES and ATOM records:

>d1fkba_ d.26.1.1 (A:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d1fkba_:

• d1fkba_ first appeared (with stable ids) in SCOP 1.55, called d1fkb__
  
• d1fkba_ appears in SCOPe 2.04
  
• d1fkba_ appears in SCOPe 2.06
  
• d1fkba_ appears in the current release, SCOPe 2.08