Lineage for d1fkb__ (1fkb -)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies) 
Superfamily d.26.1: FKBP-like [54534] (2 families) 
Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (7 proteins) 
Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species) Species Human (Homo sapiens) [TaxId:9606] [54537] (29 PDB entries) 
Domain d1fkb__: 1fkb - [38385]
Details for d1fkb__
PDB Entry: 1fkb (more details), 1.7 Å
PDB Description: atomic structure of the rapamycin human immunophilin fkbp-12 complex
SCOP Domain Sequences for d1fkb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fkb__ d.26.1.1 (-) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle
SCOP Domain Coordinates for d1fkb__:
Click to download the PDB-style file with coordinates for d1fkb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fkb__:
- d1fkb__ first appeared (with stable ids) in SCOP 1.55
- d1fkb__ appears in SCOP 1.57
- d1fkb__ appears in SCOP 1.61
- d1fkb__ appears in the current release, SCOPe 2.08, called d1fkba_
View in 3D