Lineage for d6rsyi2 (6rsy I:115-192)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2352435Protein automated matches [190374] (16 species)
    not a true protein
  7. 2352460Species Human (Homo sapiens) [TaxId:9606] [187221] (1214 PDB entries)
  8. 3083773Domain d6rsyi2: 6rsy I:115-192 [383835]
    Other proteins in same PDB: d6rsya1, d6rsya2, d6rsyb1, d6rsyb2, d6rsyd1, d6rsye1, d6rsye2, d6rsyf1, d6rsyf2, d6rsyg1, d6rsyg2, d6rsyi1, d6rsyj1, d6rsyj2
    automated match to d5wjoc2
    complexed with edo

Details for d6rsyi2

PDB Entry: 6rsy (more details), 2.95 Å

PDB Description: the complex between tcr a7b2 and human class i mhc hla-a0201-wt1 with the bound rmfpnapyl peptide.
PDB Compounds: (I:) a7b2 ALPHA CHAIN

SCOPe Domain Sequences for d6rsyi2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rsyi2 b.1.1.2 (I:115-192) automated matches {Human (Homo sapiens) [TaxId: 9606]}
niqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksn
savawsnksdfacanafn

SCOPe Domain Coordinates for d6rsyi2:

Click to download the PDB-style file with coordinates for d6rsyi2.
(The format of our PDB-style files is described here.)

Timeline for d6rsyi2:

  • d6rsyi2 is new in SCOPe 2.07-stable