SCOP 1.71: Domain d1fkd__: 1fkd -

Lineage for d1fkd__ (1fkd -)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (3 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)

6. Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
   cis-trans prolyl-isomerase

7. Species Human (Homo sapiens) [TaxId:9606] [54537] (31 PDB entries)

8. Domain d1fkd__: 1fkd - [38383]
   complexed with 818

Details for d1fkd__

PDB Entry: 1fkd, 1.72 Å

PDB Description: fk-506 binding protein: three-dimensional structure of the complex with the antagonist l-685,818

SCOP Domain Sequences for d1fkd__:

Sequence; same for both SEQRES and ATOM records:

>d1fkd__ d.26.1.1 (-) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d1fkd__:

• d1fkd__ first appeared (with stable ids) in SCOP 1.55
  
• d1fkd__ appears in SCOP 1.69
  
• d1fkd__ is called d1fkda_ in SCOP 1.73
  
• d1fkd__ appears in the current release, SCOPe 2.08, called d1fkda_