Lineage for d1bkf__ (1bkf -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 31479Fold d.26: FKBP-like [54533] (3 superfamilies)
  4. 31480Superfamily d.26.1: FKBP-like [54534] (2 families) (S)
  5. 31481Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (5 proteins)
  6. 31489Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
  7. 31493Species Human (Homo sapiens) [TaxId:9606] [54537] (28 PDB entries)
  8. 31494Domain d1bkf__: 1bkf - [38382]

Details for d1bkf__

PDB Entry: 1bkf (more details), 1.6 Å

PDB Description: fk506 binding protein fkbp mutant r42k/h87v complex with immunosuppressant fk506

SCOP Domain Sequences for d1bkf__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bkf__ d.26.1.1 (-) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens)}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdknkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatgvpgiipphatlvfdvellkle

SCOP Domain Coordinates for d1bkf__:

Click to download the PDB-style file with coordinates for d1bkf__.
(The format of our PDB-style files is described here.)

Timeline for d1bkf__: