SCOPe 2.06: Domain d1dzoa1: 1dzo A:29-144

Lineage for d1dzoa1 (1dzo A:29-144)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.24: Pili subunits [54522] (1 superfamily)
   contains very long N-terminal helix, which end is packed against beta-sheet

4. Superfamily d.24.1: Pili subunits [54523] (8 families)
   bacterial filament proteins

5. Family d.24.1.1: Pilin [54524] (5 proteins)

6. Protein Type IV Pilin Pak [109620] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [54527] (3 PDB entries)

8. Domain d1dzoa1: 1dzo A:29-144 [38378]
   Other proteins in same PDB: d1dzoa2

Details for d1dzoa1

PDB Entry: 1dzo, 1.63 Å

PDB Description: truncated pak pilin from pseudomonas aeruginosa

PDB Compounds: (A:) type IV pilin

SCOPe Domain Sequences for d1dzoa1:

Sequence; same for both SEQRES and ATOM records:

>d1dzoa1 d.24.1.1 (A:29-144) Type IV Pilin Pak {Pseudomonas aeruginosa [TaxId: 287]}
arsegasalasvnplkttveealsrgwsvksgtgtedatkkevplgvaadanklgtialk
pdpadgtaditltftmggagpknkgkiitltrtaadglwkctsdqdeqfipkgcsr

Timeline for d1dzoa1:

• d1dzoa1 first appeared (with stable ids) in SCOP 1.55, called d1dzoa_
  
• d1dzoa1 was called d1dzoa_ in SCOPe 2.05
  
• d1dzoa1 appears in SCOPe 2.07
  
• d1dzoa1 appears in the current release, SCOPe 2.08