SCOPe 2.08: Domain d6rsya2: 6rsy A:183-276

Lineage for d6rsya2 (6rsy A:183-276)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88605] (203 PDB entries)
   Uniprot P30685 25-300 ! Uniprot P30443 25-298 # 1A01_HUMAN HLA class I histocompatibility antigen, A-1 alpha chain precursor ! Uniprot P30481 25-300 ! Uniprot P01892 25-298 ! Uniprot P13746 25-299 # 1A11_HUMAN HLA class I histocompatibility antigen, A-11 alpha chain precursor

8. Domain d6rsya2: 6rsy A:183-276 [383691]
   Other proteins in same PDB: d6rsya1, d6rsyb1, d6rsyb2, d6rsyd1, d6rsyd2, d6rsye1, d6rsye2, d6rsyf1, d6rsyg1, d6rsyg2, d6rsyi1, d6rsyi2, d6rsyj1, d6rsyj2
   automated match to d1ogaa1
   complexed with edo

Details for d6rsya2

PDB Entry: 6rsy, 2.95 Å

PDB Description: the complex between tcr a7b2 and human class i mhc hla-a0201-wt1 with the bound rmfpnapyl peptide.

PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d6rsya2:

Sequence; same for both SEQRES and ATOM records:

>d6rsya2 b.1.1.2 (A:183-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
tdapkthmthhavsdheatlrcwalsfypaeitltwqrdgedqtqdtelvetrpagdgtf
qkwaavvvpsgqeqrytchvqheglpkpltlrwe

Timeline for d6rsya2:

• d6rsya2 first appeared in SCOPe 2.07