Lineage for d6rsya1 (6rsy A:2-182)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2506503Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2506504Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2506505Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2506604Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2506631Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (103 PDB entries)
    Uniprot P01892 25-298
  8. 3083628Domain d6rsya1: 6rsy A:2-182 [383690]
    Other proteins in same PDB: d6rsya2, d6rsyb1, d6rsyb2, d6rsyd1, d6rsyd2, d6rsye1, d6rsye2, d6rsyf2, d6rsyg1, d6rsyg2, d6rsyi1, d6rsyi2, d6rsyj1, d6rsyj2
    automated match to d1ogaa2
    complexed with edo

Details for d6rsya1

PDB Entry: 6rsy (more details), 2.95 Å

PDB Description: the complex between tcr a7b2 and human class i mhc hla-a0201-wt1 with the bound rmfpnapyl peptide.
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d6rsya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6rsya1 d.19.1.1 (A:2-182) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d6rsya1:

Click to download the PDB-style file with coordinates for d6rsya1.
(The format of our PDB-style files is described here.)

Timeline for d6rsya1:

  • d6rsya1 is new in SCOPe 2.07-stable