Class b: All beta proteins [48724] (180 folds) |
Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
Superfamily b.19.1: Viral protein domain [49818] (4 families) forms homotrimers |
Family b.19.1.0: automated matches [227246] (1 protein) not a true family |
Protein automated matches [227017] (58 species) not a true protein |
Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [327808] (18 PDB entries) |
Domain d6nhpa1: 6nhp A:11-329 [383657] Other proteins in same PDB: d6nhpa2, d6nhpb_, d6nhpc2, d6nhpd_, d6nhpe2, d6nhpf_ automated match to d4xkga_ complexed with nag; mutant |
PDB Entry: 6nhp (more details), 2.25 Å
SCOPe Domain Sequences for d6nhpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6nhpa1 b.19.1.0 (A:11-329) automated matches {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]} atlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctlidal lgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegftwtgv tqnggsnackrgpgsgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhpstnqe qtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvinsngn liaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacpkyvk qntlklatgmrnvpekqtr
Timeline for d6nhpa1: