Lineage for d6nhrf_ (6nhr F:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3040825Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) (S)
  5. 3040826Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins)
  6. 3040827Protein Influenza hemagglutinin (stalk) [58066] (22 species)
    trimer
  7. 3040945Species Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId:506350] [311114] (21 PDB entries)
  8. 3040948Domain d6nhrf_: 6nhr F: [383654]
    Other proteins in same PDB: d6nhra1, d6nhra2, d6nhrc1, d6nhrc2, d6nhre1, d6nhre2
    automated match to d4d00d_
    complexed with nag; mutant

Details for d6nhrf_

PDB Entry: 6nhr (more details), 2.1 Å

PDB Description: crystal structure of the a/hong kong/1/1968 (h3n2) influenza virus hemagglutinin ha2 i45f mutant
PDB Compounds: (F:) Hemagglutinin HA2 chain

SCOPe Domain Sequences for d6nhrf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6nhrf_ h.3.1.1 (F:) Influenza hemagglutinin (stalk) {Influenza A virus (strain a/hong kong/1/1968 h3n2) [TaxId: 506350]}
glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaafdqingklnrviektn
ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe
ktgrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrf

SCOPe Domain Coordinates for d6nhrf_:

Click to download the PDB-style file with coordinates for d6nhrf_.
(The format of our PDB-style files is described here.)

Timeline for d6nhrf_: