Class b: All beta proteins [48724] (180 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) |
Family b.40.4.0: automated matches [191416] (1 protein) not a true family |
Protein automated matches [190576] (52 species) not a true protein |
Species Plasmodium falciparum [TaxId:5843] [354073] (9 PDB entries) |
Domain d6kabd1: 6kab D:78-225 [383418] Other proteins in same PDB: d6kaba2, d6kabb2, d6kabc2, d6kabd2 automated match to d3bjua1 protein/RNA complex; complexed with d4u, lys |
PDB Entry: 6kab (more details), 2.89 Å
SCOPe Domain Sequences for d6kabd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6kabd1 b.40.4.0 (D:78-225) automated matches {Plasmodium falciparum [TaxId: 5843]} vdprlyfenrskfiqdqkdkginpyphkfertisipefiekykdlgngehledtilnitg rimrvsasgqklrffdlvgdgekiqvlanysfhnhekgnfaecydkirrgdivgivgfpg kskkgelsifpketillsaclhmlpmky
Timeline for d6kabd1: