SCOPe 2.08: Domain d6kbfb2: 6kbf B:229-581

Lineage for d6kbfb2 (6kbf B:229-581)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (24 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:5843] [354075] (9 PDB entries)

8. Domain d6kbfb2: 6kbf B:229-581 [383309]
   Other proteins in same PDB: d6kbfa1, d6kbfb1
   automated match to d3bjua2
   protein/RNA complex; complexed with d4x, dms, gol, lys

Details for d6kbfb2

PDB Entry: 6kbf, 1.92 Å

PDB Description: crystal structure of plasmodium lysyl-trna synthetase in complex with a cladosporin derivative 3

PDB Compounds: (B:) Lysine--tRNA ligase

SCOPe Domain Sequences for d6kbfb2:

Sequence; same for both SEQRES and ATOM records:

>d6kbfb2 d.104.1.0 (B:229-581) automated matches {Plasmodium falciparum [TaxId: 5843]}
dteiryrqryldllinessrhtfvtrtkiinflrnflnergffevetpmmnliagganar
pfithhndldldlylriatelplkmlivggidkvyeigkvfrnegidnthnpeftscefy
wayadyndlikwsedffsqlvyhlfgtykisynkdgpenqpieidftppypkvsiveeie
kvtntileqpfdsnetiekminiikehkielpnpptaaklldqlashfienkyndkpffi
vehpqimsplakyhrtkpglterlemficgkevlnaytelndpfkqkecfklqqkdrekg
dteaaqldsafctsleyglpptgglglgidritmfltnknsikdvilfptmrp

Timeline for d6kbfb2:

• d6kbfb2 first appeared in SCOPe 2.07