SCOPe 2.04: Domain d1ayzb_: 1ayz B:

Lineage for d1ayzb_ (1ayz B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species)

7. Species Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId:4932] [54499] (1 PDB entry)

8. Domain d1ayzb_: 1ayz B: [38327]

Details for d1ayzb_

PDB Entry: 1ayz, 2.6 Å

PDB Description: crystal structure of the saccharomyces cerevisiae ubiquitin-conjugating enzyme rad6 (ubc2) at 2.6a resolution

PDB Compounds: (B:) ubiquitin-conjugating enzyme rad6

SCOPe Domain Sequences for d1ayzb_:

Sequence; same for both SEQRES and ATOM records:

>d1ayzb_ d.20.1.1 (B:) Ubiquitin conjugating enzyme, UBC {Baker's yeast (Saccharomyces cerevisiae), ubc2 (RAD6) [TaxId: 4932]}
stparrrlmrdfkrmkedappgvsasplpdnvmvwnamiigpadtpyedgtfrlllefde
eypnkpphvkflsemfhpnvyangeicldilqnrwtptydvasiltsiqslfndpnpasp
anveaatlfkdhksqyvkrvketveksweddmd

Timeline for d1ayzb_:

• d1ayzb_ first appeared (with stable ids) in SCOP 1.55
  
• d1ayzb_ appears in SCOPe 2.03
  
• d1ayzb_ appears in SCOPe 2.05
  
• d1ayzb_ appears in the current release, SCOPe 2.08