SCOPe 2.08: Domain d6w9cc2: 6w9c C:62-315

Lineage for d6w9cc2 (6w9c C:62-315)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins)
   C-terminal part of Pfam PF08715

6. Protein Papain-like protease PLpro, catalytic domain [310795] (4 species)

7. Species Severe acute respiratory syndrome coronavirus 2 [TaxId:2697049] [383236] (1 PDB entry)

8. Domain d6w9cc2: 6w9c C:62-315 [383255]
   Other proteins in same PDB: d6w9ca1, d6w9cb1, d6w9cc1
   automated match to d2fe8a2
   complexed with cl, zn

Details for d6w9cc2

PDB Entry: 6w9c, 2.7 Å

PDB Description: the crystal structure of papain-like protease of sars cov-2

PDB Compounds: (C:) non-structural protein 3

SCOPe Domain Sequences for d6w9cc2:

Sequence, based on SEQRES records:

>d6w9cc2 d.3.1.23 (C:62-315) Papain-like protease PLpro, catalytic domain {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
dtlrveafeyyhttdpsflgrymsalnhtkkwkypqvngltsikwadnncylatalltlq
qielkfnppalqdayyrarageaanfcalilaycnktvgelgdvretmsylfqhanldsc
krvlnvvcktcgqqqttlkgveavmymgtlsyeqfkkgvqipctcgkqatkylvqqespf
vmmsappaqyelkhgtftcaseytgnyqcghykhitsketlycidgalltksseykgpit
dvfykensytttik

Sequence, based on observed residues (ATOM records):

>d6w9cc2 d.3.1.23 (C:62-315) Papain-like protease PLpro, catalytic domain {Severe acute respiratory syndrome coronavirus 2 [TaxId: 2697049]}
dtlrveafeyyhttdpsflgrymsalnhtkkwkypqvngltsikwadnncylatalltlq
qielkfnppalqdayyrarageaanfcalilaycnktvgelgdvretmsylfqhanldsc
krvlnvvcktcgqqqttlkgveavmymgtlsyeqfkkgvqipcgkqatkylvqqespfvm
msappaqyelkhgtftcaseytgnyqcghykhitsketlycidgalltksseykgpitdv
fykensyttti

Timeline for d6w9cc2:

• d6w9cc2 first appeared in SCOPe 2.07