Lineage for d1exua2 (1exu A:4-176)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 78647Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 78648Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 78649Family d.19.1.1: MHC antigen-recognition domain [54453] (7 proteins)
  6. 78893Protein MHC-related Fc receptor [54492] (1 species)
  7. 78894Species Human (Homo sapiens) [TaxId:9606] [54493] (1 PDB entry)
  8. 78895Domain d1exua2: 1exu A:4-176 [38324]
    Other proteins in same PDB: d1exua1, d1exub1

Details for d1exua2

PDB Entry: 1exu (more details), 2.7 Å

PDB Description: crystal structure of the human mhc-related fc receptor

SCOP Domain Sequences for d1exua2:

Sequence, based on SEQRES records: (download)

>d1exua2 d.19.1.1 (A:4-176) MHC-related Fc receptor {Human (Homo sapiens)}
hlsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawvwenqvswywek
ettdlrikeklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlk
qgtwggdwpealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew

Sequence, based on observed residues (ATOM records): (download)

>d1exua2 d.19.1.1 (A:4-176) MHC-related Fc receptor {Human (Homo sapiens)}
hlsllyhltavsspapgtpafwvsgwlgpqqylsynslrgeaepcgawywekettdlrik
eklfleafkalggkgpytlqgllgcelgpdntsvptakfalngeefmnfdlkqgtwggdw
pealaisqrwqqqdkaankeltfllfscphrlrehlergrgnlew

SCOP Domain Coordinates for d1exua2:

Click to download the PDB-style file with coordinates for d1exua2.
(The format of our PDB-style files is described here.)

Timeline for d1exua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1exua1
View in 3D
Domains from other chains:
(mouse over for more information)
d1exub1