Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (9 species) |
Species Human (Homo sapiens) [TaxId:9606] [54239] (312 PDB entries) Uniprot P62988 identical sequence in many other species |
Domain d6upuc_: 6upu C: [383238] Other proteins in same PDB: d6upub2, d6upuf2, d6upuh2, d6upuj2, d6upuk2, d6upun2, d6upup2 automated match to d4k1rb_ |
PDB Entry: 6upu (more details), 2.2 Å
SCOPe Domain Sequences for d6upuc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6upuc_ d.15.1.1 (C:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} mqifvktltgktitlevepsdtienvkakiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d6upuc_: