Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class I MHC homolog [54489] (4 species) gamma, delta T-cell ligand |
Species Mouse (Mus musculus), t22 [TaxId:10090] [54491] (1 PDB entry) |
Domain d1c16g2: 1c16 G:1-180 [38323] Other proteins in same PDB: d1c16a1, d1c16b_, d1c16c1, d1c16d_, d1c16e1, d1c16f_, d1c16g1, d1c16h_ |
PDB Entry: 1c16 (more details), 3.1 Å
SCOP Domain Sequences for d1c16g2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c16g2 d.19.1.1 (G:1-180) Class I MHC homolog {Mouse (Mus musculus), t22} gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeadnweqq trivtiqgqlsernlmtlvhfynksmddshtlqwlqgcdvepdrhlclwynqlaydsedl ptlnenpssctvgnstvphisqdlkshcsdllqkylekgkerll
Timeline for d1c16g2: