SCOP 1.75: Domain d1c16e2: 1c16 E:1-180

Lineage for d1c16e2 (1c16 E:1-180)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)

6. Protein Class I MHC homolog [54489] (4 species)
   gamma, delta T-cell ligand

7. Species Mouse (Mus musculus), t22 [TaxId:10090] [54491] (2 PDB entries)

8. Domain d1c16e2: 1c16 E:1-180 [38322]
   Other proteins in same PDB: d1c16a1, d1c16b_, d1c16c1, d1c16d_, d1c16e1, d1c16f_, d1c16g1, d1c16h_

Details for d1c16e2

PDB Entry: 1c16, 3.1 Å

PDB Description: crystal structure analysis of the gamma/delta t cell ligand t22

PDB Compounds: (E:) MHC-like protein t22

SCOP Domain Sequences for d1c16e2:

Sequence, based on SEQRES records:

>d1c16e2 d.19.1.1 (E:1-180) Class I MHC homolog {Mouse (Mus musculus), t22 [TaxId: 10090]}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeadnweqq
trivtiqgqlsernlmtlvhfynksmddshtlqwlqgcdvepdrhlclwynqlaydsedl
ptlnenpssctvgnstvphisqdlkshcsdllqkylekgkerll

Sequence, based on observed residues (ATOM records):

>d1c16e2 d.19.1.1 (E:1-180) Class I MHC homolog {Mouse (Mus musculus), t22 [TaxId: 10090]}
gshslryfytavsrpglgepwfiivgyvddmqvlrfsskeetprmapwleqeeadnweqq
trivtiqgqlsernlmtlvhfynksmddshtlqwlqgcdvepdrhlclwynqlaydsedl
ptlnenpssctphisqdlkshcsdllqkylekgkerll

Timeline for d1c16e2:

• d1c16e2 first appeared (with stable ids) in SCOP 1.55
  
• d1c16e2 appears in SCOP 1.73
  
• d1c16e2 appears in SCOPe 2.01
  
• d1c16e2 appears in the current release, SCOPe 2.08