Lineage for d6pvcg1 (6pvc G:2-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2755807Domain d6pvcg1: 6pvc G:2-110 [383207]
    Other proteins in same PDB: d6pvca1, d6pvca3, d6pvcb1, d6pvcb2, d6pvcc1, d6pvcc3, d6pvcd1, d6pvcd2, d6pvce2, d6pvcg2
    automated match to d2f54d1
    complexed with act, gol, na, p1j

Details for d6pvcg1

PDB Entry: 6pvc (more details), 1.96 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-db28
PDB Compounds: (G:) Human TCR alpha chain

SCOPe Domain Sequences for d6pvcg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pvcg1 b.1.1.0 (G:2-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrfs
sflsrskgysylllkelqmkdsasylcavkdsnyqliwgagtkliikpd

SCOPe Domain Coordinates for d6pvcg1:

Click to download the PDB-style file with coordinates for d6pvcg1.
(The format of our PDB-style files is described here.)

Timeline for d6pvcg1: