Lineage for d1b3ja2 (1b3j A:1-180)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719375Protein Class I MHC homolog [54489] (4 species)
    gamma, delta T-cell ligand
  7. 719376Species Human (Homo sapiens), Mic-a [TaxId:9606] [54490] (2 PDB entries)
  8. 719378Domain d1b3ja2: 1b3j A:1-180 [38319]
    Other proteins in same PDB: d1b3ja1
    complexed with nag

Details for d1b3ja2

PDB Entry: 1b3j (more details), 3 Å

PDB Description: structure of the mhc class i homolog mic-a, a gammadelta t cell ligand
PDB Compounds: (A:) MHC class I homolog mic-a

SCOP Domain Sequences for d1b3ja2:

Sequence, based on SEQRES records: (download)

>d1b3ja2 d.19.1.1 (A:1-180) Class I MHC homolog {Human (Homo sapiens), Mic-a [TaxId: 9606]}
ephslrynltvlswdgsvqsgfltevhldgqpflrcdrqkcrakpqgqwaedvlgnktwd
retrdltgngkdlrmtlahikdqkeglhslqeirvceihednstrssqhfyydgelflsq
nletkewtmpqssraqtlamnvrnflkedamktkthyhamhadclqelrrylksgvvlrr

Sequence, based on observed residues (ATOM records): (download)

>d1b3ja2 d.19.1.1 (A:1-180) Class I MHC homolog {Human (Homo sapiens), Mic-a [TaxId: 9606]}
ephslrynltvlswdgsvqsgfltevhldgqpflrcdrqkcrakpqgqwaedvlgnktwd
retrdltgngkdlrmtlahikdqkeglhslqeirvceihednstrssqhfyydgelflsq
nletkewtmpqssraqtlamnvrnflkedamadclqelrrylksgvvlrr

SCOP Domain Coordinates for d1b3ja2:

Click to download the PDB-style file with coordinates for d1b3ja2.
(The format of our PDB-style files is described here.)

Timeline for d1b3ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b3ja1