Lineage for d1zagc2 (1zag C:6-183)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1898097Protein Zinc-alpha-2-glycoprotein, ZAG [54487] (1 species)
    fat depleting factor related to class I MHC
  7. 1898098Species Human (Homo sapiens) [TaxId:9606] [54488] (7 PDB entries)
    Uniprot P25311 22-294
  8. 1898105Domain d1zagc2: 1zag C:6-183 [38317]
    Other proteins in same PDB: d1zaga1, d1zagb1, d1zagc1, d1zagd1
    complexed with nag, ndg

Details for d1zagc2

PDB Entry: 1zag (more details), 2.8 Å

PDB Description: human zinc-alpha-2-glycoprotein
PDB Compounds: (C:) protein (zinc-alpha-2-glycoprotein)

SCOPe Domain Sequences for d1zagc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zagc2 d.19.1.1 (C:6-183) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens) [TaxId: 9606]}
grysltyiytglskhvedvpafqalgslndlqffrynskdrksqpmglwrqvegmedwkq
dsqlqkaredifmetlkdiveyyndsngshvlqgrfgceiennrssgafwkyyydgkdyi
efnkeipawvpfdpaaqitkqkweaepvyvqrakayleeecpatlrkylkysknildr

SCOPe Domain Coordinates for d1zagc2:

Click to download the PDB-style file with coordinates for d1zagc2.
(The format of our PDB-style files is described here.)

Timeline for d1zagc2: