Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries) |
Domain d6pvca1: 6pvc A:1-178 [383167] Other proteins in same PDB: d6pvca2, d6pvca3, d6pvcb1, d6pvcb2, d6pvcc2, d6pvcc3, d6pvcd1, d6pvcd2, d6pvce1, d6pvce2, d6pvcf1, d6pvcf2, d6pvcg1, d6pvcg2, d6pvch1, d6pvch2 automated match to d4l4va1 complexed with act, gol, na, p1j |
PDB Entry: 6pvc (more details), 1.96 Å
SCOPe Domain Sequences for d6pvca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6pvca1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d6pvca1: