Lineage for d6pvca1 (6pvc A:1-178)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938673Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)
  8. 2938750Domain d6pvca1: 6pvc A:1-178 [383167]
    Other proteins in same PDB: d6pvca2, d6pvca3, d6pvcb1, d6pvcb2, d6pvcc2, d6pvcc3, d6pvcd1, d6pvcd2, d6pvce1, d6pvce2, d6pvcf1, d6pvcf2, d6pvcg1, d6pvcg2, d6pvch1, d6pvch2
    automated match to d4l4va1
    complexed with act, gol, na, p1j

Details for d6pvca1

PDB Entry: 6pvc (more details), 1.96 Å

PDB Description: structure of human mait a-f7 tcr in complex with human mr1-db28
PDB Compounds: (A:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d6pvca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pvca1 d.19.1.0 (A:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d6pvca1:

Click to download the PDB-style file with coordinates for d6pvca1.
(The format of our PDB-style files is described here.)

Timeline for d6pvca1: