Lineage for d1ed3a2 (1ed3 A:1-181)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 719351Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 719352Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 719353Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 719393Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 719720Species Rat (Rattus norvegicus), RT1-AA [TaxId:10116] [54486] (3 PDB entries)
  8. 719722Domain d1ed3a2: 1ed3 A:1-181 [38313]
    Other proteins in same PDB: d1ed3a1, d1ed3b_, d1ed3d1, d1ed3e_

Details for d1ed3a2

PDB Entry: 1ed3 (more details), 2.55 Å

PDB Description: crystal structure of rat minor histocompatibility antigen complex rt1- aa/mtf-e.
PDB Compounds: (A:) class I major histocompatibility antigen rt1-aa

SCOP Domain Sequences for d1ed3a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ed3a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Rat (Rattus norvegicus), RT1-AA [TaxId: 10116]}
gshslryfytavsrpglgeprfiavgyvddtefvrfdsdaenprmeprarwmeregpeyw
eqqtriakeweqiyrvdlrtlrgyynqseggshtiqemygcdvgsdgsllrgyrqdaydg
rdyialnedlktwtaadfaaqitrnkweraryaerlraylegtcvewlsrylelgketll
r

SCOP Domain Coordinates for d1ed3a2:

Click to download the PDB-style file with coordinates for d1ed3a2.
(The format of our PDB-style files is described here.)

Timeline for d1ed3a2: