Lineage for d1ddha2 (1ddh A:1-181)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897285Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (28 species)
  7. 1897650Species Mouse (Mus musculus), H-2DD [TaxId:10090] [54485] (20 PDB entries)
  8. 1897684Domain d1ddha2: 1ddh A:1-181 [38312]
    Other proteins in same PDB: d1ddha1, d1ddhb_

Details for d1ddha2

PDB Entry: 1ddh (more details), 3.1 Å

PDB Description: mhc class i h-2dd heavy chain complexed with beta-2 microglobulin and an immunodominant peptide p18-i10 from the human immunodeficiency virus envelope glycoprotein 120
PDB Compounds: (A:) MHC class I h-2dd heavy chain

SCOPe Domain Sequences for d1ddha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddha2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DD [TaxId: 10090]}
mshslryfvtavsrpgfgeprymevgyvdntefvrfdsdaenpryeprarwieqegpeyw
eretrrangneqsfrvdlrtalryynqsaggshtlqwmagcdvesdgrllrgywqfaydg
cdyialnedlktwtaadmaaqitrrkweqagaaerdraylegecvewlrrylkngnatll
a

SCOPe Domain Coordinates for d1ddha2:

Click to download the PDB-style file with coordinates for d1ddha2.
(The format of our PDB-style files is described here.)

Timeline for d1ddha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ddha1
View in 3D
Domains from other chains:
(mouse over for more information)
d1ddhb_